Toggle menu
+31 20 808 0893

C1orf151 Antibody, middle region | Gentaur

€340.00
(No reviews yet) Write a Review
SKU:
247-ARP44801_P050-GEN
Availability:
IN STOCK
Size:
100 µg
Adding to cart… category.add_cart_announcement

Product Description

C1orf151 Antibody, middle region

Product Info Tested Species Reactivity Human

Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit

Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clonality Polyclonal

Host Rabbit

Application WB

Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf151

Purification Affinity Purified

Predicted Homology Based on

Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Complete computational species homology data Anti-C1orf151 (ARP44801_P050)

Peptide Sequence Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Concentration 0.5 mg/ml

Product Videos

Custom Field

Size 100 µg

Product Reviews

Write a Review